PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462927021
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family NF-YA
Protein Properties Length: 303aa    MW: 32963.4 Da    PI: 9.7069
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462927021genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA1041.3e-32146202158
  CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                +ep++VNaKQy++Il+RRq Rakle+++kl  k+rkpylheSRh+hA++R+RgsgGrF
  462927021 146 EEPIFVNAKQYHAILRRRQVRAKLEAQNKL-VKARKPYLHESRHRHAMKRARGSGGRF 202
                69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.6E-37144205IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.512145205IPR001289Nuclear transcription factor Y subunit A
PfamPF020456.4E-28147202IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.3E-24148170IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860150170IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.3E-24179202IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MEGYPVHSMP NYDFLSGNGY SMKHLARSNS DGDCSSTSSE QSRQDVSAVS DSSLNGQYTP  60
IHTDNNDNCG KQDQDAIKSV LSLGNPEAAF SPQKFDYSQP FACVSYPYAA DSYYGGILTG  120
YTSNANTHPN GTTNSRVPLP VEPAAEEPIF VNAKQYHAIL RRRQVRAKLE AQNKLVKARK  180
PYLHESRHRH AMKRARGSGG RFLNKKELQE QQKAPPSPQT PTGGVSKVGN DGNPYTANRT  240
SKLPSTPTSS GISSVSNGGG MLAHQGHISF SSTNFLPSMN FAIQNRGEKM AVNDVPYRAS  300
TVR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A8e-24146207263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1186195RHRHAMKRAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004984046.11e-144PREDICTED: nuclear transcription factor Y subunit A-4-like isoform X2
TrEMBLA0A0A9P2R91e-158A0A0A9P2R9_ARUDO; Uncharacterized protein
STRINGSi036728m1e-141(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137338121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54160.11e-34nuclear factor Y, subunit A5